INTRO Nosotros Aprendizaje Recursos Glosario   Contáctenos

GLOSARIO


Abreviaturas de uso más frecuente en bioinformática

¡Atención!
En este glosario no pretendemos conceptualizar los diferentes términos, sino brindar algunos elementos que ayuden a comprender su significado.

A-E

Ácido desoxirribonucleico (deoxyribonucleic acid)
Uno de los dos tipos fundamentales de ácidos nucleicos que se encuentran en los organismos vivos. El ácido desoxirribonucleico ó ADN es generalmente bicatenario, formando una estructura tridimensional helicoidal que se conoce como doble hélice. La pentosa en los residuos de nucleótidos que lo forman es la 2’-desoxiribosa, a la cual se unen indistintamente las bases nitrogenadas adenina (A), guanina (G), citosina (C) y timina (T). El ADN es la molécula portadora de la información genética.

Ácido nucleico (nucleic acid)
Polinucleótido natural mono o bicatenario no ramificado, en el que los residuos de nucleótidos están dispuestos en una secuencia específica y unidos por enlaces fosfodiéster. v. ácido ribonucleico y desoxirribonuleico.

Ácido ribonucleico, ARN (ribonucleic acid, RNA)
Uno de los dos tipos fundamentales de ácidos nucleicos que se encuentran en los organismos vivos. La pentosa en los residuos de nucleótidos que lo forman es la ribosa, a la cual se unen indistintamente las bases nitrogenadas adenina (A), guanina (G), citosina (C) y uracilo (U). Las diferentes formas del ARN participan en diversos procesos celulares y son claves en el proceso de biosíntesis de proteínas. v. ARN mensajero, ARN de transferencia y ARN ribosomal.

ADN (DNA)
v. Ácido desoxirribonucleico.

Alelo (allele)
Cualquiera de las formas del mismo gen que aparecen en la misma posición en el genoma, pero que se diferencian en cuanto a su secuencia nucleotídica y por tanto, pueden dar lugar a proteínas con diferente función, algunas de las cuales pueden estar implicadas en procesos patológicos.

α-hélice (α-helix)
Uno de los dos elementos básicos fundamentales de la estructura secundaria de las proteínas (el otro es la lámina β). Esta configuración helicoidal o espiral de una cadena polipeptídica se mantiene gracias a la formación de puentes de hidrógeno entre el grupo carbonilo del enlace peptídico de un residuo, con el grupo imino del enlace peptídico del tercer residuo consecutivo en la misma cadena.

Algoritmo (algorithm)
Secuencia de pasos que conforman una tarea específica, usualmente en el ámbito computacional.

Alineamiento de secuencias (sequence alignment)
Arreglo mutuo de dos o más secuencias, que muestra donde estas son similares y donde difieren. Un alineamiento óptimo es aquel que muestra la mayor cantidad de correspondencias y la menor cantidad de diferencias.

Aminoácido (amino acid)
Compuestos cuya estructura incluye un grupo amino, un grupo carboxilo y una cadena lateral de composición variable. Veinte aminoácidos conocidos como "estándar" son los principales monómeros de las cadenas polipeptídicas que forman las proteínas.

ARN (RNA)
v. Ácido ribonucleico.

ARN de transferencia, ARNt (transference RNA, tRNA)
Cualquiera de las moléculas relativamente pequeñas de ARN que median la correcta inserción de un aminoácido en la cadena polipéptídica naciente, durante el proceso de traducción.

ARN mensajero, ARNm (messenger RNA, mRNA)
Cualquiera de las moléculas de ARN monocatenario con un tiempo de vida media relativamente corto, que llevan la información contenida en los genes hasta el ribosoma, donde tiene lugar la traducción. Se forma en el núcleo de la célula mediante el proceso de transcripción del ADN.

ARN ribosomal, ARNr (ribosomal RNA, rRNA )
Cualquiera de las moléculas de ARN que forman parte de la estructura del ribosoma. Los ARN ribosomales se distinguen por su coeficiente de sedimentación (dado en unidades Svedberg ó S), por ejemplo: los ARN 5S y 23S de la subunidad mayor de los ribosomas eucariontes.

Base de datos (database)
Conjunto de datos consistente y usualmente persistente, organizado en un modo específico que permita acceder a la información de forma fácil y rápida. En el mundo de la informática existen varios sistemas que permiten gestionar bases de datos, muchos de ellos basados en el leguaje SQL, sin embargo, en la práctica, cualquier fichero que contenga información organizada según un formato específico puede considerarse como una base de datos, por ejemplo: un fichero escrito en formato FASTA o en un lenguaje de marcado como XML.

Bioinformática (bioinformatics)
De manera simplificada, la aplicación de las tecnologías de la computación y la información al manejo y análisis de información de origen biológico.

Biología computacional (computational biology)
v. Bioinformática. Este término se aplica, generalmente, a la creación de modelos computacionales a partir de datos obtenidos no necesariamente a nivel molecular.

Biología de los sistemas (systems biology)
Un nuevo enfoque de las ciencias biológicas, que se basa en el estudio de la estructura y dinámica de los sistemas biológicos como tales, apoyado pero no restringido a las evidencias experimentales obtenidas a partir del estudio de sus componentes individuales.

Biología molecular (molecular biology)
Rama de la biología que se dedica al estudio de la estructura y función de las macromoléculas esenciales para la vida (y especialmente su rol desde el punto de vista genético).

Biosíntesis de proteínas (protein byosynthesis)
Proceso de síntesis de proteínas en la célula. La biosíntesis de proteínas abarca la transcripción de la información contenida en los genes estructurales (en la forma de ADN) para formar los ARN mensajeros correspondientes; los que luego son usados en la síntesis de las cadenas polipeptídicas en los ribosomas, como parte de un proceso denominado traducción.

Célula (cell)
La unidad básica de estructura y función de todos los organismos vivos. Formada usualmente por un compartimiento principal delimitado externamente por una membrana que permite el intercambio selectivo de sustancias e información con el medio ambiente. El núcleo de la célula es el espacio que contiene la mayor parte del ADN celular y puede estar delimitado o no por una membrana conocida como membrana nuclear. Las células que carecen de membrana nuclear se conocen como procariotas y son típicas de organismos unicelulares inferiores como las bacterias (procariontes), mientras que las que presentan membrana nuclear se conocen como eucariotas y son típicas de algunos organismos unicelulares como hongos y algas, y de todos los organismos superiores (eucariontes). Las células eucariotas contienen un número variable de orgánulos dentro del compartimiento principal, algunos también delimitados por envolturas y membranas, como las mitocondrias.

CGI
del inglés common gateway interface.
Una interfaz que permite ejecutar programas en servidores web, procesando datos introducidos por un cliente remoto y devolviendo los resultados al cliente en la forma de contenido web, tal y como si el programa se hubiese ejecutado en el equipo cliente.

Cluster de computadoras (computer cluster)
Un grupo de computadoras interconectadas que funcionan como una unidad de alto rendimiento. Una de las implementaciones más populares es la basada en nodos que ejecutan Linux como sistema operativo y otros componentes de software encargados del procesamiento paralelo, conocida como cluster de tipo Beowulf.

Código abierto (open-source)
Relativo al software para el cual el código fuente está disponible en forma gratuita.

Código fuente (source code)
Conjunto de instrucciones escritas en un lenguaje específico, en la forma de un fichero de texto, que es convertido a un programa directamente ejecutable en la computadora. Este término es generalmente utilizado en el contexto de los lenguajes de compilador, en el caso de los lenguajes de intérprete se acostumbra a usar el término guión.

Consenso (consensus)
Una manera de representar la información que aporta un alineamiento de secuencias. El consenso descarta toda la información, excepto la más significativa, concentrándose sólo en las posiciones más conservadas.

Correo electrónico (e-mail)
Tecnología asociada al desarrollo de Internet que permite escribir mensajes en una computadora y enviarlos a otra computadora remota en segundos.

Doble hélice (double helix)
Arreglo de estructura tridimensional que generalmente adopta el ADN en su forma nativa. El modelo de doble hélice, propuesto por Watson y Crick en 1953, consiste en dos cadenas polinucleotídicas de ADN enrrolladas en forma helicoidal sobre el mismo eje. Esta estructura se estabiliza por los puentes de hidrógeno que se establecen entre pares de bases nitrogenadas (A-T, C-G), de manera que, uno de los miembros de cada par pertenece a una de las cadenas y el otro a la otra, denominada complementaria.

Dominio (domain)
Segmento de cadena polipeptídica que se pliega de forma independiente del resto de la cadena y que usualmente tiene una función específica. También usado para designar al segmento de gen que codifica para éste.

Entrada (entry)
Cada uno de los elementos funcionales que representan una unidad en un fichero que fue creado utilizando un formato específico. Por ejemplo: una entrada en un fichero de secuencias de proteínas está constituida por toda la información referente a una secuencia, incluida la secuencia como tal.

Enzima (enzyme)
Una macromolécula, proteína ó ARN, que cataliza una reacción específica en el metabolismo. Las enzimas (al igual que todos los catalizadores) no afectan el equilibrio de la reacción, sino que aumentan la velocidad de reacción brindando un camino de menor energía de activación.

Escisión (splicing)
Proceso mediante el cual los intrones son escindidos del ARN mensajero que fue transcripto a partir de un gen discontinuo. En algunos casos también se escinden exones (de forma controlada) dando lugar a diferentes productos proteicos que derivan del mismo gen, en un proceso que se conoce como escisión o splicing alternativo.

EST
del inglés expressed sequence tags.
Fragmentos cortos (300-500 pb) de secuencias de ADN derivadas de ARN mensajero, que se obtienen en grandes cantidades y representan un cuadro de las proteínas que se expresan en un momento o estadio de desarrollo dado. Representan las "etiquetas de expresión" de una librería de cDNAs.

Estación de trabajo (workstation)
Cualquier computadora, generalmente conectada a una red, que se usa para llevar a cabo tareas específicas de cálculo o cualquier otro tipo de procesamiento de la información. El término fue originalmente usado para referirse a computadoras de alto rendimiento con uno o varios procesadores y sistema operativo UNIX, pero en la actualidad no hay muchas diferencias entre una y otra acepción.

Estructura tridimensional (tridimensional structure)
La disposición espacial de los elementos estructurales que forman parte de las biomoléculas, la cual determina intrínsicamente su función biológica. La estructura tridimensional de una proteína está directamente determinada por la estructura primaria o secuencia aminoacídica y generalmente se subdivide en varios niveles para su mejor estudio. La estructura secundaria hace referencia a la disposición espacial de los átomos en la cadena polipeptídica, en la forma de elementos básicos que se repiten, como las α-hélices o las láminas β. La estructura terciaria hace referencia al plegamiento de la cadena polipeptídica en el espacio, considerada como un todo. La estructura cuaternaria hace referencia a la disposición espacial de las cadenas polipeptídicas en proteínas formadas por más de una cadena (proteínas multiméricas).

Estudio de asociación (association study)
Estudio de los factores que contribuyen a aumentar el riesgo de padecer una determinada enfermedad. Comúnmente aplicado a la identificación de alelos relacionados con procesos patológicos. Los alelos cuya presencia puede aumentar el riesgo de padecer una determinada enfermedad suelen encontrarse con una mayor frecuencia en individuos que padecen la enfermedad, con relación a los que no la padecen; por ejemplo, el alelo ε4 del gen de la proteína APOE está asociado a la ocurrencia de la enfermedad de Alzheimer.

Eucarionte (eukaryote)
Referido a los organismos con células eucariotas o a cualquier elemento biológico típico de estos.

Exón (exon)
Región no codificante dentro de un gen discontinuo.

Expresión (expression)
El proceso que permite que la información contenida en los genes (genotipo) se manifieste en la forma de caracteres biológicos o fenotipo. En el caso específico de los genes que codifican para proteínas, la expresión implica al proceso de biosíntesis de proteínas.

F-J

Familia (family)
Grupos de proteínas (y sus genes codificantes) que comparten características funcionales semejantes y una obvia relación entre sus secuencias.

FASTA (FASTA)
1. (algoritmo, herramienta) Una herramienta desarrollada por Pearson y Lipman para el alineamiento de secuencias de ácidos nucleicos y proteínas.
2. (formato) Uno de los formatos más simples utilizados para almacenar secuencias nucleotídicas o aminoacídicas. Una entrada con formato FASTA tiene dos bloques fundamentales, el primero está formado por una sola línea que comienza con '>' y no es más que una descripción de la secuencia y el segundo está formado por la secuencia en sí e implica tantas líneas como sea necesario. Por ejemplo: >NADH dehydrogenase I chain J
MTFQLILFYIFAVIILYGAIKTVTAKNPVHAA
VGAVMVLTFCVSAMLWMLMQAEFLGVTLVVVY
LHLVLFLFVVMMLNIDIEEMRAGFWRHAPVAG
DIPAVVGTLLAVALILILVNPKTDLAAFGLMK
DYNNIRDLGSRIYTDY

Fenotipo (phenotype)
El conjunto de caracteres biológicos o características estructurales y funcionales observables (no necesariamente a simple vista) de un organismo, determinado por el genotipo y por la interacción de este con el medio ambiente.

Filogenética (phylogenetics)
La rama de la biología que se ocupa de descubrir las líneas de origen o filogenias de los organismos, a fin de construir las relaciones antepasado-descendientes (relaciones evolutivas) entre los grupos de organismos vivos y extinguidos. En el contexto molecular estas relaciones se infieren a partir de las similitudes y diferencias en secuencias aminoacídicas o nucleotídicas.

Fisioma (physiome)
Conjunto de modelos creados para describir cuantitativamente la dinámica fisiológica y el comportamiento funcional de un organismo como un todo. Mayormente usado en el contexto humano.

Fisiómica (physiomics)
Rama de la biología que se dedica al estudio del fisioma, incluyendo los métodos y técnicas específicas que se usan con este objetivo.

Formato (format)
En el mundo de la informática, el conjunto de reglas o especificaciones mediante las cuales se pueden organizar datos de diversa naturaleza, para poder acceder posteriormente a estos a través de los intérpretes adecuados. v. lenguaje de marcado, FASTA.

FTP
del inglés file transfer protocol.
Uno de los miembros de la familia de protocolos TCP/IP, que permite el intercambio bidireccional de ficheros y manejo de directorios, entre dos computadoras en la red. Los programas que permiten llevar a cabo estas operaciones usando el protocolo FTP, se denominan clientes FTP y son similares a los clientes web como los navegadores, los cuales también intercambian información, pero utilizando el protocolo HTTP. La mayoría de los clientes web tienen integrada la función de cliente FTP.

Gen (gene)
La unidad de información genética en un organismo vivo, enmarcada por un contexto estructural y/o funcional dado. Se distinguen tres clases fundamentales de genes: (1) los genes que son transcritos a ARN mensajero y traducidos a una cadena polipetídica (conocidos como codificantes o estructurales), (2) los genes que sólo son transcritos a ARN, que codifican para ARN ribosomal o ARN de transferencia y (3) los genes reguladores de la expresión de las dos clases anteriores. Los genes estructurales típicos de los eucariontes son discontinuos, las regiones codificadoras (exones) están interrumpidas por regiones no codificadoras (intrones) que son eliminadas como parte de un proceso conocido como escisión, durante su expresión.

Genoma (genome)
El total de la información genética de un organismo o entidad biológica, dado en la forma de secuencias de ADN (excepto en algunos virus cuyo genoma está constituido por ARN). El genoma puede considerarse como estático cuando se compara con el proteoma.

Genómica (genomics)
Rama de la biología que se dedica al estudio del genoma, incluyendo los métodos y técnicas específicas que se usan con este objetivo.

Genotipo (genotype)
El total de la información genética de un organismo. A veces se intercambia con el término genoma.

Guión (script)
Conjunto de instrucciones escritas en un lenguaje de intérprete, en la forma de un fichero de texto, que es ejecutado por un intérprete adecuado.

Hardware (hardware)
En computación, los componentes físicos (mecánicos, magnéticos, electrónicos, eléctricos y ópticos) que forman parte de la computadora.

HTML
del inglés hypertext markup language.
Lenguaje de marcado
usado como el estándar para especificar el formato y delimitar el contenido de los documentos del World Wide Web o páginas web.

HTTP
del inglés hypertext-transfer protocol.
Uno de los miembros de la familia de protocolos TCP/IP, que permite el intercambio de información en el World Wide Web. HTTP es un protocolo de solicitud/respuesta entre clientes y servidores.

Interfaz de usuario (user interface)
Recurso de software, generalmente un componente central del sistema operativo, diseñado para permitir al usuario interactuar con el sistema. La interfaz de usuario más simple, conocida como consola (en inglés shell), utiliza sólo un monitor y un teclado conectado al sistema y un programa que interpreta los comandos tecleados por el usuario en la línea de comandos para ejecutar acciones específicas. En la actualidad, son comunes las interfaces gráficas de usuario ó GUIs (del inglés graphical user interface), que usan, además, dispositivos apuntadores como el ratón o mouse e incluyen múltiples elementos gráficos intuitivos como iconos o botones.

Internet (Internet)
Una amplia red global de estaciones de trabajo derivada de una red militar que se comenzó a desarrollar en 1969, en los Estados Unidos (ARPANET). ARPANET fue diseñada para ser confiable, en el sentido de que si una zona de la red era dañada, por un accidente o ataque enemigo, los mensajes entre las otras computadoras serían automáticamente redireccionados; lo que hizo que este tipo de red se popularizara y se convirtiera en el estándar actual de comunicación entre computadoras. Internet se apoya en varias tecnologías, entre ellas la familia de protocolos TCP/IP.

Intérprete (interpreter o parser)
Un programa que es capaz de interpretar un formato específico previamente definido, o sea, es capaz de dividir en elementos funcionales un fichero escrito en ese formato. El término también se aplica a los programas que ejecutan guiones escritos en lenguajes de intérprete.

Intranet (intranet)
La red local de una organización, con acceso generalmente restringido a uso interno. Muchas veces este término se usa para referirse al componente más visible y popular, que es el sitio web interno. Las intranets se construyen sobre las mismas bases, protocolos y tecnologías sobre las que está construida Internet.

Intrón (intron)
Región codificante dentro de un gen discontinuo.

K-O

Lámina β (β sheet)
Uno de los dos elementos básicos de la estructura secundaria de las proteínas (el otro es la α-hélice). Las láminas β están formadas por hojas β (en inglés: β-strands) dispuestas de forma paralela o antiparalela y conectadas por puentes de hidrógeno alternados entre los grupos carboxilo e imino del enlace peptídico de los residuos de una hoja y la adyacente.

Lenguaje de compilador (compiler language)
Un lenguaje de programación en el que el código fuente es convertido a un programa directamente ejecutable por la computadora, mediante otro programa conocido como compilador. Los programas generados por un compilador son autosuficientes, pues no se precisa de ningún programa adicional para ejecutarlos (comparar con lenguaje de intérprete). C, C++ y FORTRAN son ejemplos de lenguajes distribuidos en la forma de lenguajes de compilador.

Lenguaje de intérprete (interpreter language)
Un lenguaje de programación en el que el código fuente se presenta en la forma de ficheros de texto conocidos como guiones, que son convertidos a una forma directamente ejecutable por la computadora, línea a línea, cada vez que son ejecutados. Para esto se precisa de otro programa adicional, denominado intérprete, por lo que no son autosuficientes (comparar con lenguaje de compilador). Algunos lenguajes de intérprete están diseñados para ejecutarse sobre el WWW y muchos pueden adquirirse tanto en la forma de intérprete como en la forma de compilador. Perl, Python, JavaScript y VBScript son ejemplos de lenguajes generalmente distribuidos en la forma de lenguajes de intérprete.

Lenguaje de marcado (markup language)
Un conjunto de símbolos y reglas que se usan para especificar el formato y delimitar el contenido de un documento dado, que después será interpretado por un programa específico. Por ejemplo, el lenguaje HTML es usado para especificar el formato de las páginas web que serán presentadas en un explorador.

Librería de cDNAs (cDNA library)
Una colección de moléculas bicatenarias de ADN (cDNAs) obtenidas a partir de las moléculas de los ARN mensajeros correspondientes. Puesto que los cDNAs se obtienen a partir de moléculas de ARN mensajero, las librerías de cDNAs permiten obtener información acerca de los genes estructurales que se están expresando en la célula en un momento dado. Las librerias de cDNAs también se usan experimentalmente para conocer la secuencia codificante de los genes discontinuos típicos de eucariontes, después de que los exones han sido escindidos.

Linux
Sistema operativo derivado de UNIX que, manteniendo casi todas las ventajas que este último ofrece, puede ser ejecutado en computadoras personales. Fue desarrollado originalmente por el estudiante finlandés de informática Linus Torvalds, que publicó su código fuente en 1990, en la forma de código abierto. Este hecho, unido a la estructura modular del sistema operativo (basado en la integración de componentes de software independientes) generó una nueva visión de desarrollo informático y ha permitido que Linux se haya expandido notablemente, gracias al trabajo, muchas veces voluntario y sin ánimo de lucro, de miles de programadores a todo lo largo del mundo. Actualmente están disponibles varias distribuciones de Linux, ofertadas por diversos proveedores, como RedHat, SuSE o Mandrake Inc.

Metabolismo (metabolism)
El conjunto regulado y coordinado de reacciones químicas que tienen lugar en un organismo vivo, cada una catalizada por una enzima específica. Una vía metabólica es el conjunto de reacciones que lleva a la síntesis o degradación de una biomolécula dada, en tanto que un metabolito es un intermediario en una vía metabólica. El metabolismo es la suma del anabolismo (conjunto de las vías de síntesis, que requieren energía) y del catabolismo (conjunto de las vías de degradación, que permiten obtener la energía necesaria para poder llevar a cabo las vías de síntesis).

Metaboloma (metabolome)
El conjunto de vías metabólicas que ocurren en una célula, tejido u organismo, incluyendo su interrelación y regulación.

Metabolómica (metabolomics)
Rama de la biología que se dedica al estudio del metaboloma, incluyendo los métodos y técnicas específicas que se usan con este objetivo.

Middleware
Término usados para referirse a los componentes de software que actúan como intermediarios entre otros componentes de software, generalmente, en el marco de la interacción cliente/servidor. Ejemplos típicos son los programas desarrollados para ejecutar las consultas que diferentes usuarios de la red hacen a una base de datos central que está ubicada en el servidor.

Motivo (motif)
Regiones conservadas relativamente cortas (de 10 a 20 residuos) en un alineamiento múltiple de varias secuencias de proteínas que pertenecen a la misma familia. Los motivos, también conocidos como bloques, representan usualmente elementos importantes desde el punto de vista estructural o funcional y pueden utilizarse como descriptores de la familia en cuestión.

Mutación (mutation)
Proceso mediante el cual el material genético sufre un cambio detectable y heredable, generalmente en la forma de una variación en la secuencia del ADN. Estas variaciones pueden ser puntuales (cambio de un nucleótido por otro) o deberse a la inserción (ganancia) o deleción (pérdida) de un segmento de nucleótidos. Las mutaciones son la base de la existencia de los alelos.

Nucleótido (nucleotide)
Compuesto formado por una base nitrogenada enlazada covalentemente a una pentosa fosforilada en uno de sus residuos hidroxilo. Cinco nucleótidos son los monómeros que mayormente forman las cadenas polinucleotídicas de los ácidos nucleicos, formados por las bases nitrogenadas adenina (A), timina (T), citosina (C), guanina (G) y uracilo (U), respectivamente.

P-T

Patrón (pattern)
Descriptor de un motivo. Un patrón es una representación abreviada de la secuencia consenso de un motivo. Los patrones, también conocidos como expresiones regulares, se han utilizado para la identificación de motivos en el análisis de secuencias.

Perl
del inglés practical extraction and report language (aunque el término 'Perl' no es exactamente un acrónimo, por lo que no debe escribirse como PERL).
Un lenguaje de programación creado por Larry Wall en la década de los 80s y distribuido mayormente en la forma de un lenguaje de intérprete gratuito. Perl es un lenguaje de fácil aprendizaje, que brinda numerosas facilidades para el trabajo eficiente con cadenas de caracteres y la identificación de patrones de texto (expresiones regulares), por lo cual es muy usado en el análisis de secuencias biológicas.

PHP
del inglés hypertext preprocessor (acrónimo recursivo).
Un lenguaje de programación utilizado mayormente para desarrollar servicios web. PHP es un lenguaje de fácil aprendizaje, distribuido en forma gratuita, que permite interactuar con muchos sistemas de gestión de bases de datos.

Plegamiento (folding)
El proceso a través del cual una cadena polipeptídica (proteína) adquiere una estructura tridimensional específica y única.

Procarionte (prokaryote)
Referido a los organismos con células procariotas o a cualquier elemento biológico típico de estos.

Procesamiento paralelo (parallel processing)
Ejecución simultánea de una misma tarea (dividida y adaptada especialmente) en múltiples procesadores, con el fin de obtener resultados en menor tiempo y de manera más eficiente. El procesamiento paralelo se implementa en clusters de computadoras.

Proteína (protein)
Una macromolécula compuesta por una o más cadenas polipeptídicas, cada una con una secuencia característica de aminoácidos enlazados por enlace peptídico. Las proteínas son las principales macromoléculas que forman parte de los organismos vivos y son cruciales en prácticamente todas las funciones celulares.

Proteoma (proteome)
El conjunto de proteínas que se están expresando en un momento dado, en una célula, tejido u organismo. El proteoma puede considerarse como dinámico si se compara con el genoma, pues varía con el tiempo y/o con diferentes estados fisiológicos o patológicos específicos.

Proteómica (proteomics)
Rama de la biología que se dedica al estudio del proteoma, incluyendo los métodos y técnicas específicas que se usan con este objetivo.

Protocolo (protocol)
Conjunto de reglas que definen el intercambio de datos entre computadoras. Cada protocolo se encarga de una forma específica de intercambio, por ejemplo el protocolo SMTP de la familia TCP/IP se encarga de la recepción de mensajes de correo entrante.

Proyectos de secuenciación de genomas (genome sequencing proyects)
Programas de colaboración científica, generalmente entre varias naciones, cuyo objetivo es obtener un conocimiento básico acerca de la secuencia y función de los genes incluidos en el genoma de una o varias especies.

Recombinación (recombination)
El proceso a través del cual se forma un nuevo genotipo, generalmente debido a reordenamientos que ocurren a nivel del genoma.

Recurso computacional (computational resource)
Cualquier elemento de naturaleza computacional (generalmente de software) que asiste al usuario en la realización de una tarea específica. Los recursos computacionales son generalmente bases de datos ó programas (también conocidos como aplicaciones) que se encuentran en la misma estación de trabajo o en servidores remotos a los que se accede vía Internet (v. servicio web).

Red (network)
Un conjunto de elementos ó nodos interconectados entre sí por un conjunto de relaciones binarias.
1. En computación, un grupo de computadoras que pueden comunicarse entre sí utilizando cualquiera de los protocolos que se han desarrollado con este objetivo. Originalmente, este término se usaba para designar a un grupo de computadoras físicamente conectadas entre sí. En la actualidad, gracias al surgimiento de los sistemas de redes de tipo Internet, el hecho de que dos computadoras puedan comunicarse no implica necesariamente que exista una conexión física entre ambas, pues los mensajes viajan de computadora en computadora a todo lo largo de la red, hasta alcanzar su destino correcto.
2. En biología, una forma de representar varios procesos o sistemas que evidencian un alto grado de interrelación entre sus componentes, por ejemplo, el metabolismo y su regulación, la regulación de la expresión de los genes o la interconexión entre las neuronas en el contexto del sistema nervioso.

Registro (record)
v. Entrada. El término registro se usa preferiblemente para designar las entradas de bases de datos creadas con un lenguaje profesional como SQL.

Replicación (replication)
Proceso en el cual se obtienen dos moléculas de ADN doble cadena hijas a partir de una molécula doble cadena parental. Cada una de las dobles hélices hijas está formada por una hebra de la molécula parental y una sintetizada como parte del proceso, por lo que este se describe como semiconservativo.

Revolución genómica (genomic revolution)
Término utilizado para hacer referencia a la explosión masiva de información que se ha generado y continúa generándose como resultado de varias décadas de investigación en el campo de la biología molecular y de la fundación de múltiples proyectos de secuenciación de genomas a nivel mundial. Se usa también el término era postgenómica (luego de que en 2000, dos grupos independientes presentaran el primer borrador del genoma humano) para enmarcar este momento crucial en el desarrollo de la biología.

Ribosoma (ribosome)
Un agregado supramolecular intracelular de cerca de 200 Å de diámetro, formado por ARN y proteínas. El ribosoma es el sitio de la traducción del ARN mensajero en el proceso de biosíntesis de proteínas. Los ribosomas, tanto en eucariontes como en procariontes, están formados por dos subunidades que se distinguen por su coeficiente de sedimentación (dado en unidades Svedberg ó S): una mayor (de 50S en procariontes y de 60S en eucariontes) y una menor (de 30S en procariontes y de 40S en eucariontes).

Secuencia (sequence)
La disposición ordinal de los monómeros que forman parte de las biomoléculas de tipo "polimérico" como los ácidos nucleicos y las proteínas. La mayor parte de la información en el contexto de los sistemas biológicos está representada en la forma de secuencias nucleotídicas (en los ácidos nucleicos) y aminoacídicas (en las proteínas). Las variaciones en la secuencia nucleotídica de los genes que codifican para proteínas, debidas a mutaciones, pueden mediar variaciones en la secuencia aminoacídica de estas proteínas. En tanto que, tales variaciones en la secuencia aminoacídica de las proteínas, usualmente acarrean variaciones en su estructura tridimensional y por ende, en su función.

Servicio web (web service)
Recurso de software que se ejecuta en un servidor web remoto, en respuesta a la solicitud hecha por un cliente. Los servicios web son equivalentes a cualquier aplicación que corre en un equipo local, sólo que la información necesaria para llevar a cabo una tarea específica es enviada al servidor y el resultado de esa tarea, devuelto al usuario, ambos en la forma de contenido web.

Servidor (server)
Componentes de software (y las computadoras en que estos se ejecutan) que se encargan de realizar una o varias tareas en función de terceros, generalmente en el contexto de una red. Los componentes de software (y las computadoras en que estos se ejecutan) que se sirven o hacen uso de las funciones que llevan a cabo los servidores, se denomina clientes. Los servidores se ocupan de gestionar el tráfico en la red, manejar la identificación de cada una de las estaciones de trabajo que forman parte de esta y brindar una gran cantidad de servicios a los clientes, como acceso a ficheros e Internet, correo electrónico, etc.
Los servidores web son aquellos que se encargan de servir contenido web, vía el protocolo HTTP, a los clientes web, mayormente exploradores o navegadores (en inglés browsers), como Mozilla ó Microsoft© Internet Explorer.

Similitud (similarity)
Una medida de la semejanza entre dos secuencias, que no necesariamente implica una relación de parentezco entre estas. En la práctica, la similitud entre dos secuencias se expresa en base al por ciento que representa el número de residuos idénticos en el alineamiento, con respecto al número total de residuos en la secuencia más corta, valor que se conoce como por ciento de similitud o identidad.

Sistema operativo (operating system)
El software responsable del control y manejo directo del hardware y las operaciones básicas del sistema, así como de la ejecución de otros recursos de software. El sistema operativo es el primer elemento de software que se carga en la memoria del ordenador, por lo que todos los recursos que se ejecutan posteriormente dependen exclusivamente de las prestaciones que este sea capaz de brindar. Por esta razón, muchas veces se usan los términos entorno o plataforma de ejecución para referirse a un sistema operativo. La mayoría de los sistemas operativos llevan a cabo un conjunto de operaciones básicas como el manejo de la memoria, acceso a unidades de almacenamiento e implementación de las interfaces de usuario. El componente que se dedica a estas operaciones se conoce, generalmente, como kernel o núcleo. Actualmente, los sistemas operativos usados en la mayoría de los servidores y estaciones de trabajo, a nivel mundial, se han consolidado en dos grandes familias: la familia Microsoft© Windows™ (9x, Me, NT, XP, etc.) y la familia de productos UNIX/Linux.

Software (software)
En computación, procedimientos y reglas lógicas escritas en la forma de programas y aplicaciones, que definen el modo de operación de la computadora. Tienen carácter virtual (en contraposición con el hardware) y están almacenadas en los diferentes tipos de memoria de lectura/escritura.

SQL
del inglés structured query language.
Un lenguaje que se ha convertido en uno de los estándares actuales para la gestión de bases de datos. Hoy existen varios sistemas profesionales basados en SQL, que permiten una gestión eficiente de bases de datos y el acceso a estas sobre redes e Internet, por ejemplo: MySQL ó PostgreSQL.

TCP/IP
del inglés transfer control protocol/internet protocol.
Familia de protocolos sobre los cuales funciona Internet, que se ha convertido en el estándar actual de comunicación entre computadoras. Conocida por estas siglas debido a que los dos protocolos más importantes son: el protocolo IP, que se ocupa de transferir los paquetes de datos hasta su destino adecuado y el protocolo TCP, que se ocupa de garantizar que la transferencia se lleve a cabo de forma correcta y confiable.

Traducción (translation)
El proceso mediante el cual la información contenida en una molécula de ARN mensajero especifica la secuencia de aminoácidos para la síntesis de una cadena polipeptídica, durante el proceso de biosíntesis de proteínas.

Transcripción (transcription)
El proceso mediante el cual la información contenida en una de las hebras de una molécula de ADN es usada como molde para la síntesis enzimática de una cadena de ARN, con una secuencia complementaria a la de la cadena de ADN que sirvió de molde.

Transcriptoma (transcriptome)
El total de todas las formas de ARNs transcriptos a partir del genoma, en un célula, tejido u organismo. El transcriptoma, al igual que el proteoma, puede considerarse como dinámico cuando se compara con el genoma. A veces se circunscribe sólo al conjunto de los ARNs mensajeros.

Transcriptómica (transcriptomics)
Rama de la biología que se dedica al estudio del transcriptoma, incluyendo los métodos y técnicas específicas que se usan con este objetivo.

U-Z

Unidades Svedberg, S (Svedberg units, S)
Una unidad coherente, no perteneciente al sistema internacional, usada para medir el coeficiente de sedimentación de macromoléculas y componentes celulares. El coeficiente de sedimentación dado en unidades Svedberg se usa comúnmente para distinguir entre varias formas distintas de moléculas de la misma naturaleza química o biológica, como el ARN.

UNIX
Sistema operativo multiusuario y multitarea, desarrollado originalmente por Ken Thompson y Dennis Ritchie en los laboratorios Bell en 1969, para su uso en minicomputadoras. Ofrece múltiples ventajas y se considera potente, más portable e independiente de equipos concretos que otros sistemas operativos. El UNIX está disponible en varias formas, entre las que se encuentran AIX, una versión de UNIX adaptada por IBM (para su uso en estaciones de trabajo basadas en RISC), Solaris, versión de Sun Mycrosystems y A/UX (versión gráfica para equipos Apple Macintosh).

URL
del inglés uniform resource locator.
Un identificador único y uniforme para cada recurso en un sistema basado en la familia de protocolos TCP/IP, como una intranet o Internet. El URL de un sitio comienza con un identificador del tipo de protocolo que se usará para comunicarse con este sitio, así, los basados en el protocolo HTTP comienzan con 'http://', mientras que los basados en el protocolo FTP comienzan con 'ftp://'. Seguido de este prefijo aparece el nombre de la computadora en la que se encuentra el recurso y la ruta completa para acceder a este. El URL de esta página es 'http://fbio.uh.cu/bioinfo/glosario.html'.

World Wide Web (WWW)
Un sistema de intercambio de información capaz de manipular varios tipos de medios, basado en el protocolo HTTP. La característica principal del Worl Wide Web (a veces abreviado como WWW ó web) es que los diferentes sitios, identificados por un URL único, pueden referirse de forma cruzada por elementos de texto "activo" conocidos como hipervínculos o enlaces. El World Wide Web es una de las bases de Internet.

XML
del inglés extensible markup language.
Un lenguaje de marcado extensible que puede usarse para almacenar datos en un formato estructurado, basado en texto y definido por el usuario.

 


Para profundizar en muchos de estos términos, consulte Wikipedia, una enciclopedia gratuita en línea.


ergito.com ofrece un extenso glosario de términos biológicos, con referencias a publicaciones reconocidas como Genes VIII de B. Lewin.


De la célula a la supercomputadora, especialistas del Centro Nacional de Bioinformática (BIOINFO) hablan sobre esta disciplina y su desarrollo en Cuba.


Presentación de la conferencia sobre Bioinformática y Biología de los sistemas, ofrecida por el Dr. Agustín Lage en la UH (Sept. 2004).